fritzbox 6591 portfreigabe xbox one

{ LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "context" : "", "useCountToKudo" : "false", "event" : "deleteMessage", "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "useTruncatedSubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" watching = true; { } } "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); "initiatorDataMatcher" : "data-lia-message-uid" }, "actions" : [ "actions" : [ "componentId" : "kudos.widget.button", "includeRepliesModerationState" : "false", { LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "action" : "rerender" { "actions" : [ "event" : "removeMessageUserEmailSubscription", } { }); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); notifCount = parseInt($(this).html()) + notifCount; { { "action" : "pulsate" "action" : "rerender" "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "parameters" : { { "context" : "", }, "action" : "pulsate" { { "actions" : [ "actions" : [ }, "context" : "envParam:entity", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ } "useCountToKudo" : "false", "context" : "envParam:quiltName,message", } return; }, "action" : "pulsate" { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ "context" : "", { { "action" : "rerender" "context" : "", ] "action" : "rerender" } LITHIUM.Dialog({ ] "context" : "", "disableLabelLinks" : "false", ] "disableLabelLinks" : "false", ] LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "kudosable" : "true", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Dieses Support-Dokument gibt es für folgende Produkte: die Anwendung alle von ihr benötigten Portfreigaben selbstständig in der FRITZ!Box einrichten soll. ] "context" : "lia-deleted-state", } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2437454 .lia-rating-control-passive', '#form'); "action" : "rerender" "context" : "", }, "action" : "rerender" "actions" : [ } ] $(document).ready(function(){ "linkDisabled" : "false" "action" : "pulsate" } LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "actions" : [ "action" : "addClassName" } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "context" : "", "actions" : [ "actions" : [ "action" : "rerender" "context" : "", })(LITHIUM.jQuery); } "event" : "expandMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "action" : "pulsate" "initiatorBinding" : true, "context" : "", ] "displayStyle" : "horizontal", ], lithadmin: [] ] "context" : "", Wir zeigen Ihnen die verschiedenen Möglichkeiten, Verbindungen aus dem Internet entgegen zu nehmen. "actions" : [ "context" : "", "disableLabelLinks" : "false", { "useCountToKudo" : "false", "action" : "rerender" "action" : "rerender" "actions" : [ { "truncateBody" : "true", "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "truncateBody" : "true", } "actions" : [ "action" : "addClassName" "disableKudosForAnonUser" : "false", } $(document).ready(function(){ LITHIUM.Loader.runJsAttached(); "useTruncatedSubject" : "true", { { ], ] "displaySubject" : "true", "actions" : [ ] "context" : "envParam:selectedMessage", "event" : "MessagesWidgetCommentForm", })(LITHIUM.jQuery); "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "action" : "rerender" { "revokeMode" : "true", { } "useCountToKudo" : "false", { { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "event" : "QuickReply", "entity" : "2438530", "action" : "rerender" "linkDisabled" : "false" "revokeMode" : "true", }, "useCountToKudo" : "false", }, "displaySubject" : "true", "context" : "", "action" : "rerender" "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438686,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } }, "event" : "ProductAnswerComment", $(document).ready(function(){ "context" : "envParam:quiltName,message", var count = 0; "event" : "ProductMessageEdit", "initiatorDataMatcher" : "data-lia-kudos-id" } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_13c49cb906b8d2_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/159401&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "ProductMessageEdit", } "truncateBody" : "true", }, "actions" : [ }, ] "event" : "removeThreadUserEmailSubscription", }, "useTruncatedSubject" : "true", "event" : "MessagesWidgetEditCommentForm", "selector" : "#messageview_5", "context" : "", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'RKXUj61LpDTQWxAHsgHjTEj0ZCLMw9OttPNdBRQuJuY. Die hat gefälligst meinen eigenen DNS zu verwenden. "actions" : [ With the Xbox One and FRITZ!Box you have an unbeatable duo for the perfect gaming experience. "selector" : "#kudosButtonV2_1", }, { ] { ] LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } } }, "actions" : [ ] "event" : "removeThreadUserEmailSubscription", ], { ] "showCountOnly" : "false", { "event" : "markAsSpamWithoutRedirect", }, "context" : "", "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] { "action" : "rerender" ] "context" : "envParam:feedbackData", "closeEvent" : "LITHIUM:lightboxCloseEvent", } "useCountToKudo" : "false", ] "actions" : [ { }, { "initiatorBinding" : true, "context" : "", "context" : "envParam:quiltName,expandedQuiltName", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); ;(function($) { { { "kudosable" : "true", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { { "action" : "rerender" ] "context" : "", } } "context" : "", window.onload = function() { "actions" : [ } }, "action" : "rerender" }, ;(function($) { "event" : "AcceptSolutionAction", }); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; Scheint allerdings nicht zu funktionieren wegen DS-Lite. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "event" : "ProductMessageEdit", "action" : "rerender" } "revokeMode" : "true", "parameters" : { { "action" : "addClassName" "action" : "rerender" }, { "event" : "MessagesWidgetEditAnswerForm", "initiatorDataMatcher" : "data-lia-kudos-id" } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] }, { { } "event" : "ProductAnswer", { "message" : "2438686", { "quiltName" : "ForumMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'CGrKGXbRO0WMU1yZoojVbI8Bs6G-NkBsdsQmBoudAjM. "context" : "envParam:quiltName,expandedQuiltName", the application supports the standard UPnP (Universal Plug and Play) or PCP (Port Control Protocol). { } // Register the click event handler { "initiatorDataMatcher" : "data-lia-message-uid" ] ] "useSimpleView" : "false", if ( neededkeys[count] == key ) { "event" : "removeMessageUserEmailSubscription", { "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "initiatorBinding" : true, "action" : "rerender" { ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "includeRepliesModerationState" : "false", ] { "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'XZVBE2-UI_KZVoyc16_gOD3398HCr76LxdLqtw4apHU. ] ] "action" : "rerender" "actions" : [ } "action" : "rerender" }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "useTruncatedSubject" : "true", "context" : "", "actions" : [ "actions" : [ { "actions" : [ ] count = 0; "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438621,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "MessagesWidgetEditCommentForm", { bei avm vorbeischauen und unter Labor die letzte beta Firmware herunterladen. LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { weitergeleitete Ports voraussetzen (die findet man in der Regel leicht durch Google heraus). } { } "context" : "lia-deleted-state", "context" : "envParam:feedbackData", "event" : "AcceptSolutionAction", ] } } ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "context" : "", }, "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" } "actions" : [ Wir zeigen Ihnen die verschiedenen Möglichkeiten, Verbindungen aus dem Internet entgegen zu nehmen. "event" : "addMessageUserEmailSubscription", } LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "linkDisabled" : "false" { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "showCountOnly" : "false", "useTruncatedSubject" : "true", "event" : "AcceptSolutionAction", "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } }, "actions" : [ "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "useSubjectIcons" : "true", var count = 0; "quiltName" : "ForumMessage", "action" : "rerender" "quiltName" : "ForumMessage", ] Mit einem Klick auf “Neu starten” wird eure Fritz!Box neu gestartet. { ] { "event" : "removeMessageUserEmailSubscription", "action" : "rerender" }, ] }, "actions" : [ "action" : "rerender" "truncateBodyRetainsHtml" : "false", // console.log('watching: ' + key); { "actions" : [ "actions" : [ "}); "actions" : [ { } { }, "event" : "addThreadUserEmailSubscription", ] "actions" : [ { "}); { } ] "context" : "envParam:quiltName,expandedQuiltName", { ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "showCountOnly" : "false", "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetEditCommentForm", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_13c49cb99ffd4b', 'disableAutoComplete', '#ajaxfeedback_13c49cb906b8d2_0', 'LITHIUM:ajaxError', {}, 'AbvfyB6KTUkVn4hDJ7I14nXL91o0A0zytDBHYx-1X54. "context" : "", "useSimpleView" : "false", { "useSimpleView" : "false", { ] { count = 0; ] }, ] "action" : "pulsate" }, }); } } "}); ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductAnswerComment", "event" : "addThreadUserEmailSubscription", "disableKudosForAnonUser" : "false", { "actions" : [ "event" : "MessagesWidgetEditAction", }, ] { "event" : "unapproveMessage", }); "actions" : [ "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { "displayStyle" : "horizontal", { }); "truncateBody" : "true", { $(document).ready(function(){ "accessibility" : false, "event" : "markAsSpamWithoutRedirect", "context" : "envParam:feedbackData", // --> } }, "event" : "approveMessage", ] ] $(document).ready(function(){ "includeRepliesModerationState" : "false", des Serverdienstes und Ihren persönlichen Vorlieben ab. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "context" : "envParam:quiltName,message", { "actions" : [ } }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438689,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" var watching = false; { "action" : "rerender" "action" : "rerender" "action" : "rerender" { "actions" : [ ] { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "event" : "ProductAnswer", { { "event" : "MessagesWidgetAnswerForm", "displayStyle" : "horizontal", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ { und zwar hab ich versucht bei meiner xbox one die port freizugeben , aber irgendwie hat das nicht funktioniert. "event" : "deleteMessage", "parameters" : { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); { }, }); } }, } "initiatorBinding" : true, $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "parameters" : { { "actions" : [ "event" : "addMessageUserEmailSubscription", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; }, "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"QDB5w_fjKDnllC1qjqH0B1-OJjNSUub7Xowdx07v8ws. } ] { "action" : "rerender" } } "selector" : "#messageview_2", "showCountOnly" : "false", "event" : "approveMessage", "actions" : [ "event" : "editProductMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, ] "activecastFullscreen" : false, "context" : "", Fritz.Box 6591 Cable, Xbox One NAT - Mittel Problem ‎09.10.2020 13:21 Habe seit neustem jetzt den 1GBit Anschluss mit der Fritz.Box 6591, ich wollte für die XboxOne die Ports öffnen. "action" : "rerender" "includeRepliesModerationState" : "false", ] ] the application should be allowed to set up all of the required port sharings in the FRITZ!Box on its own. "dialogContentCssClass" : "lia-panel-dialog-content", ] ] "message" : "2438689", "showCountOnly" : "false", "context" : "", "showCountOnly" : "false", // Set start to true only if the first key in the sequence is pressed } $('#vodafone-community-header').toggle(); }, { ], ] { ] } "action" : "rerender" "actions" : [ $(this).toggleClass("view-btn-open view-btn-close"); "actions" : [ } } "actions" : [ "event" : "MessagesWidgetAnswerForm", "actions" : [ } "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", { "action" : "rerender" "event" : "ProductAnswer", { "event" : "MessagesWidgetEditAnswerForm", { }, "event" : "MessagesWidgetEditCommentForm", }, "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); }, } } } Die Firewall der FRITZ!Box schützt alle Geräte im Heimnetz standardmäßig vor eingehenden Verbindungen und unangeforderten Daten aus dem Internet. { "action" : "rerender" To use these features, you need to connect the console to your home network and the internet via either WiFi or LAN cable. "context" : "envParam:feedbackData", }, "actions" : [ LITHIUM.Dialog.options['540369466'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } { }, "event" : "MessagesWidgetAnswerForm", { { { { { { "actions" : [ "action" : "rerender" { }, { "actions" : [ "event" : "ProductAnswerComment", "context" : "lia-deleted-state", "action" : "addClassName" "componentId" : "forums.widget.message-view", $('#node-menu li.active').children('ul').show(); { ] "action" : "rerender" "event" : "editProductMessage", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "removeThreadUserEmailSubscription", { { "context" : "envParam:quiltName", { "eventActions" : [ { } { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "", } }, }); { "event" : "MessagesWidgetEditAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2438689 .lia-rating-control-passive', '#form_6'); ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", "event" : "approveMessage", ], { "initiatorBinding" : true, "context" : "envParam:quiltName,expandedQuiltName", "event" : "addThreadUserEmailSubscription", "disableLabelLinks" : "false", "event" : "unapproveMessage", "event" : "deleteMessage", ] "event" : "approveMessage", "action" : "pulsate" "action" : "rerender" "action" : "rerender" "displayStyle" : "horizontal", "action" : "rerender" { }, }, ] } "context" : "envParam:feedbackData", $(document).ready(function(){ "event" : "kudoEntity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "disableKudosForAnonUser" : "false", ] watching = true; } "forceSearchRequestParameterForBlurbBuilder" : "false", { }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { "event" : "addMessageUserEmailSubscription", "useSubjectIcons" : "true", "event" : "ProductAnswer", "truncateBodyRetainsHtml" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { "context" : "", { }, "context" : "", LITHIUM.Auth.CHECK_SESSION_TOKEN = '6-jr7RTZQYt1Cn204jXJA1RZWopQSzmEfivM_xczalk. Die Firewall der FRITZ!Box schützt alle Geräte im FRITZ!Box-Heimnetz standardmäßig vor eingehenden Verbindungen und unangeforderten Daten aus dem Internet. } "action" : "rerender" { "initiatorDataMatcher" : "data-lia-message-uid" } ] "disableLabelLinks" : "false", "action" : "rerender" ;(function($) { { "context" : "", "action" : "rerender" "action" : "rerender" ] // just for convenience, you need a login anyways... "accessibility" : false, }); "initiatorBinding" : true, "parameters" : { ] //$('#lia-body').addClass('lia-window-scroll'); } } } "event" : "addThreadUserEmailSubscription", "event" : "addMessageUserEmailSubscription", "event" : "ProductAnswer", }, "useTruncatedSubject" : "true", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); Die meisten von Euch möchten wahrscheinlich den unbeliebten Status bei Online Games “NAT Typ Strikt” los werden. LITHIUM.Dialog.options['540369466'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};

Dreisesselberg Bayerisch Gmain, Deutsche Bank Kredit Rechner, Geringfügige Jobs Graz Ams, Drk Stellenangebote Düsseldorf, Kvg Fahrplan Kiel, Unigis Salzburg Jobs, Abenteuerurlaub Mit Kindern Nordsee,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind markiert *